SCOP 1.65: Domain d1dugb2: 1dug B:1-80

Lineage for d1dugb2 (1dug B:1-80)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (8 PDB entries)

8. Domain d1dugb2: 1dug B:1-80 [33013]
   Other proteins in same PDB: d1duga1, d1dugb1

Details for d1dugb2

PDB Entry: 1dug, 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization

SCOP Domain Sequences for d1dugb2:

Sequence; same for both SEQRES and ATOM records:

>d1dugb2 c.47.1.5 (B:1-80) Class alpha GST {Schistosoma japonicum}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

Timeline for d1dugb2:

• d1dugb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dugb2 appears in SCOP 1.63
  
• d1dugb2 appears in SCOP 1.67
  
• d1dugb2 appears in the current release, SCOPe 2.08