Lineage for d5m8gf1 (5m8g F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (35 PDB entries)
  8. 2286822Domain d5m8gf1: 5m8g F:1-76 [330123]
    Other proteins in same PDB: d5m8ga1, d5m8ga2, d5m8gb1, d5m8gb2, d5m8gc1, d5m8gc2, d5m8gd1, d5m8gd2, d5m8ge_, d5m8gf2, d5m8gf3
    automated match to d3tiia1
    complexed with 918, acp, ca, gdp, gol, gtp, mes, mg

Details for d5m8gf1

PDB Entry: 5m8g (more details), 2.15 Å

PDB Description: tubulin-mtd265 complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5m8gf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m8gf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5m8gf1:

Click to download the PDB-style file with coordinates for d5m8gf1.
(The format of our PDB-style files is described here.)

Timeline for d5m8gf1:

  • d5m8gf1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23