SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t2yb_ (5t2y B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069779Family b.81.1.8: PglD-like [159280] (2 protein domains)
    contains extra N-terminal alpha/beta subdomain
  6. 2286811Protein automated matches [330112] (1 species)
    not a true protein
  7. 2286812Species Campylobacter jejuni [TaxId:192222] [330113] (1 PDB entry)
  8. 2286818Domain d5t2yb_: 5t2y B: [330119]
    automated match to d3bfpa_
    complexed with 753, dms, gol

Details for d5t2yb_

PDB Entry: 5t2y (more details), 1.94 Å

PDB Description: crystal structure of c. jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid
PDB Compounds: (B:) UDP-N-acetylbacillosamine N-acetyltransferase

SCOPe Domain Sequences for d5t2yb_:

Sequence, based on SEQRES records: (download)

>d5t2yb_ b.81.1.8 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records): (download)

>d5t2yb_ b.81.1.8 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfmkfestlpkydffiaignneirkk
iyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvi
ehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqde
kgvfvgvpakrm

SCOPe Domain Coordinates for d5t2yb_:

Click to download the PDB-style file with coordinates for d5t2yb_.
(The format of our PDB-style files is described here.)

Timeline for d5t2yb_:

  • d5t2yb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23