Lineage for d5t2yb_ (5t2y B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069779Family b.81.1.8: PglD-like [159280] (2 protein domains)
    contains extra N-terminal alpha/beta subdomain
  6. 2286811Protein automated matches [330112] (1 species)
    not a true protein
  7. 2286812Species Campylobacter jejuni [TaxId:192222] [330113] (2 PDB entries)
  8. 2286818Domain d5t2yb_: 5t2y B: [330119]
    automated match to d3bfpa_
    complexed with 753, dms, gol

Details for d5t2yb_

PDB Entry: 5t2y (more details), 1.94 Å

PDB Description: crystal structure of c. jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid
PDB Compounds: (B:) UDP-N-acetylbacillosamine N-acetyltransferase

SCOPe Domain Sequences for d5t2yb_:

Sequence, based on SEQRES records: (download)

>d5t2yb_ b.81.1.8 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records): (download)

>d5t2yb_ b.81.1.8 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfmkfestlpkydffiaignneirkk
iyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvi
ehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqde
kgvfvgvpakrm

SCOPe Domain Coordinates for d5t2yb_:

Click to download the PDB-style file with coordinates for d5t2yb_.
(The format of our PDB-style files is described here.)

Timeline for d5t2yb_:

  • d5t2yb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23