SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t2pb1 (5t2p B:1-149)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999890Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 1999891Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 1999892Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 protein domains)
  6. 1999899Protein automated matches [191131] (3 species)
    not a true protein
  7. 1999907Species Hepatitis B virus [TaxId:10407] [256206] (5 PDB entries)
  8. 2286816Domain d5t2pb1: 5t2p B:1-149 [330117]
    Other proteins in same PDB: d5t2pb2, d5t2pd2
    automated match to d4bmga_
    complexed with cl, dms, gol, ipa, k89; mutant

Details for d5t2pb1

PDB Entry: 5t2p (more details), 1.69 Å

PDB Description: hepatitis b virus core protein y132a mutant in complex with sulfamoylbenzamide (sba_r01)
PDB Compounds: (B:) Core protein

SCOPe Domain Sequences for d5t2pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2pb1 a.62.1.1 (B:1-149) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstlpettvv

SCOPe Domain Coordinates for d5t2pb1:

Click to download the PDB-style file with coordinates for d5t2pb1.
(The format of our PDB-style files is described here.)

Timeline for d5t2pb1:

  • d5t2pb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23