SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ieqa_ (5ieq A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223731Fold e.77: PA C-terminal domain-like [254112] (1 superfamily)
    Pfam PF00603; PubMed 18615018; complex fold with N-terminal a+b domain and C-terminal all-a domain
  4. 2223732Superfamily e.77.1: PA C-terminal domain-like [254132] (1 family) (S)
  5. 2223733Family e.77.1.1: PA C-terminal domain-like [254167] (2 protein domains)
  6. 2223737Protein automated matches [254658] (4 species)
    not a true protein
  7. 2286700Species Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [330001] (7 PDB entries)
  8. 2286814Domain d5ieqa_: 5ieq A: [330115]
    automated match to d3cm8a_
    complexed with 1ci, dms

Details for d5ieqa_

PDB Entry: 5ieq (more details), 2.2 Å

PDB Description: crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to fragment hit ebsi-747 1-(4- chlorophenyl)-1h-imidazole
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5ieqa_:

Sequence, based on SEQRES records: (download)

>d5ieqa_ e.77.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
prplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvk
phekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgenmapekvdfddc
kdvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigedaapiehiasmrrn
yftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtkegrrktnlygfi
ikgrshlrndtdvvnfvsmefsltdprlephkwekycvlevgdmllrsaighvsrpmfly
vrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeffenksetwpvges
pkgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdnlepgtfdlg
glyeaieeclindpwvllnaswfnsflth

Sequence, based on observed residues (ATOM records): (download)

>d5ieqa_ e.77.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
prplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvk
phekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqne
fnkaceltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintall
nascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdp
rlephkwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslq
qiesmieaessvkekdmtkeffenkspkgveegsigkvcrtllaksvfnslyaspqlegf
saesrklllivqalrdnlgglyeaieeclindpwvllnaswfnsflth

SCOPe Domain Coordinates for d5ieqa_:

Click to download the PDB-style file with coordinates for d5ieqa_.
(The format of our PDB-style files is described here.)

Timeline for d5ieqa_:

  • d5ieqa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23