SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ilua_ (5ilu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 1983803Species Human (Homo sapiens) [TaxId:9606] [186924] (15 PDB entries)
  8. 2286806Domain d5ilua_: 5ilu A: [330107]
    automated match to d4avpa_

Details for d5ilua_

PDB Entry: 5ilu (more details), 1.1 Å

PDB Description: autoinhibited etv4
PDB Compounds: (A:) ets translocation variant 4

SCOPe Domain Sequences for d5ilua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilua_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alqlwqflvallddptnahfiawtgrgmefkliepeevarlwgiqknrpamnydklsrsl
ryyyekgimqkvageryvykfvcepealfslafpdnq

SCOPe Domain Coordinates for d5ilua_:

Click to download the PDB-style file with coordinates for d5ilua_.
(The format of our PDB-style files is described here.)

Timeline for d5ilua_:

  • d5ilua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23