SCOPe 2.06: Domain d1gsqa2: 1gsq A:1-75

Lineage for d1gsqa2 (1gsq A:1-75)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)

8. Domain d1gsqa2: 1gsq A:1-75 [33010]
   Other proteins in same PDB: d1gsqa1
   complexed with gdn

Details for d1gsqa2

PDB Entry: 1gsq, 2.4 Å

PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gsqa2:

Sequence; same for both SEQRES and ATOM records:

>d1gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

Timeline for d1gsqa2:

• d1gsqa2 first appeared (with stable ids) in SCOP 1.55, called d1gsq_2
  
• d1gsqa2 appears in SCOPe 2.05
  
• d1gsqa2 appears in SCOPe 2.07
  
• d1gsqa2 appears in the current release, SCOPe 2.08