SCOP 1.69: Domain d1gsq_2: 1gsq 1-75

Lineage for d1gsq_2 (1gsq 1-75)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)

8. Domain d1gsq_2: 1gsq 1-75 [33010]
   Other proteins in same PDB: d1gsq_1

Details for d1gsq_2

PDB Entry: 1gsq, 2.4 Å

PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods

SCOP Domain Sequences for d1gsq_2:

Sequence; same for both SEQRES and ATOM records:

>d1gsq_2 c.47.1.5 (1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

Timeline for d1gsq_2:

• d1gsq_2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsq_2 appears in SCOP 1.67
  
• d1gsq_2 appears in SCOP 1.71
  
• d1gsq_2 appears in the current release, SCOPe 2.08, called d1gsqa2