Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
Superfamily d.7.1: LysM domain [54106] (2 families) automatically mapped to Pfam PF01476 |
Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
Protein automated matches [234001] (7 species) not a true protein |
Species Volvox carteri [TaxId:3068] [330095] (3 PDB entries) |
Domain d5k2la_: 5k2l A: [330096] automated match to d4uz3c_ complexed with edo |
PDB Entry: 5k2l (more details), 1.2 Å
SCOPe Domain Sequences for d5k2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k2la_ d.7.1.0 (A:) automated matches {Volvox carteri [TaxId: 3068]} mgctytiqpgdtfwaiaqrrgttvdviqslnpgvnparlqvgqvinvpc
Timeline for d5k2la_: