SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k2la_ (5k2l A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156385Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2156386Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2156395Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2156396Protein automated matches [234001] (4 species)
    not a true protein
  7. 2286794Species Volvox carteri [TaxId:3068] [330095] (1 PDB entry)
  8. 2286795Domain d5k2la_: 5k2l A: [330096]
    automated match to d4uz3c_
    complexed with edo

Details for d5k2la_

PDB Entry: 5k2l (more details), 1.2 Å

PDB Description: crystal structure of lysm domain from volvox carteri chitinase
PDB Compounds: (A:) Chitinase, lysozyme

SCOPe Domain Sequences for d5k2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2la_ d.7.1.0 (A:) automated matches {Volvox carteri [TaxId: 3068]}
mgctytiqpgdtfwaiaqrrgttvdviqslnpgvnparlqvgqvinvpc

SCOPe Domain Coordinates for d5k2la_:

Click to download the PDB-style file with coordinates for d5k2la_.
(The format of our PDB-style files is described here.)

Timeline for d5k2la_:

  • d5k2la_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23