SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mwua_ (5mwu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144986Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2144991Species Escherichia coli [TaxId:562] [102695] (20 PDB entries)
  8. 2286791Domain d5mwua_: 5mwu A: [330092]
    automated match to d1zlqa1
    complexed with 6rp, act, cl, cmo, edt, fe, gol, ru, so4

Details for d5mwua_

PDB Entry: 5mwu (more details), 1.8 Å

PDB Description: crystal structure of the periplasmic nickel-binding protein nika from escherichia coli in complex with ru(bpza)(co)2cl
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d5mwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwua_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

SCOPe Domain Coordinates for d5mwua_:

Click to download the PDB-style file with coordinates for d5mwua_.
(The format of our PDB-style files is described here.)

Timeline for d5mwua_:

  • d5mwua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23