Lineage for d5m7ed2 (5m7e D:246-441)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (45 PDB entries)
  8. 2286789Domain d5m7ed2: 5m7e D:246-441 [330090]
    Other proteins in same PDB: d5m7ea1, d5m7eb1, d5m7ec1, d5m7ed1, d5m7ee_, d5m7ef1, d5m7ef2, d5m7ef3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5

Details for d5m7ed2

PDB Entry: 5m7e (more details), 2.05 Å

PDB Description: tubulin-bkm120 complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5m7ed2:

Sequence, based on SEQRES records: (download)

>d5m7ed2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5m7ed2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqaltvpeltqqmfdsknmmaacdpr
hgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsat
fignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyq
datad

SCOPe Domain Coordinates for d5m7ed2:

Click to download the PDB-style file with coordinates for d5m7ed2.
(The format of our PDB-style files is described here.)

Timeline for d5m7ed2:

  • d5m7ed2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23