SCOP 1.65: Domain d2gsq_2: 2gsq 1-75

Lineage for d2gsq_2 (2gsq 1-75)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class sigma GST [81362] (4 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)

8. Domain d2gsq_2: 2gsq 1-75 [33009]
   Other proteins in same PDB: d2gsq_1
   complexed with gbi, so4

Details for d2gsq_2

PDB Entry: 2gsq, 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_2:

Sequence; same for both SEQRES and ATOM records:

>d2gsq_2 c.47.1.5 (1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

Timeline for d2gsq_2:

• d2gsq_2 first appeared (with stable ids) in SCOP 1.55
  
• d2gsq_2 appears in SCOP 1.63
  
• d2gsq_2 appears in SCOP 1.67
  
• d2gsq_2 appears in the current release, SCOPe 2.08, called d2gsqa2