Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
Protein Class sigma GST [81362] (4 species) |
Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries) |
Domain d2gsq_2: 2gsq 1-75 [33009] Other proteins in same PDB: d2gsq_1 complexed with gbi, so4 |
PDB Entry: 2gsq (more details), 2.2 Å
SCOP Domain Sequences for d2gsq_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsq_2 c.47.1.5 (1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus)} pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm sqsmciarhlarefg
Timeline for d2gsq_2: