Lineage for d2gsq_2 (2gsq 1-75)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245199Protein Class sigma GST [81362] (3 species)
  7. 245206Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)
  8. 245207Domain d2gsq_2: 2gsq 1-75 [33009]
    Other proteins in same PDB: d2gsq_1
    complexed with gbi, so4

Details for d2gsq_2

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsq_2 c.47.1.5 (1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

SCOP Domain Coordinates for d2gsq_2:

Click to download the PDB-style file with coordinates for d2gsq_2.
(The format of our PDB-style files is described here.)

Timeline for d2gsq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsq_1