Lineage for d5m7ge_ (5m7g E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (66 PDB entries)
  8. 2286786Domain d5m7ge_: 5m7g E: [330087]
    Other proteins in same PDB: d5m7ga1, d5m7ga2, d5m7gb1, d5m7gb2, d5m7gc1, d5m7gc2, d5m7gd1, d5m7gd2, d5m7gf1, d5m7gf2, d5m7gf3
    automated match to d4i55e_
    complexed with acp, ca, fb7, gdp, gol, gtp, mes, mg

Details for d5m7ge_

PDB Entry: 5m7g (more details), 2.25 Å

PDB Description: tubulin-mtd147 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5m7ge_:

Sequence, based on SEQRES records: (download)

>d5m7ge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5m7ge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5m7ge_:

Click to download the PDB-style file with coordinates for d5m7ge_.
(The format of our PDB-style files is described here.)

Timeline for d5m7ge_:

  • d5m7ge_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23