SCOPe 2.06: Domain d1pd222: 1pd2 2:1-75

Lineage for d1pd222 (1pd2 2:1-75)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (1 PDB entry)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1pd222: 1pd2 2:1-75 [33008]
   Other proteins in same PDB: d1pd211, d1pd221
   complexed with gsh

Details for d1pd222

PDB Entry: 1pd2, 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

PDB Compounds: (2:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1pd222:

Sequence; same for both SEQRES and ATOM records:

>d1pd222 c.47.1.5 (2:1-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

Timeline for d1pd222:

• d1pd222 first appeared (with stable ids) in SCOP 1.55
  
• d1pd222 appears in SCOPe 2.05
  
• d1pd222 appears in SCOPe 2.07
  
• d1pd222 appears in the current release, SCOPe 2.08