Lineage for d1pd222 (1pd2 2:1-75)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181273Species Rat (Rattus norvegicus), class sigma [TaxId:10116] [52875] (1 PDB entry)
  8. 181275Domain d1pd222: 1pd2 2:1-75 [33008]
    Other proteins in same PDB: d1pd211, d1pd221

Details for d1pd222

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd222:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd222 c.47.1.5 (2:1-75) Glutathione S-transferase {Rat (Rattus norvegicus), class sigma}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

SCOP Domain Coordinates for d1pd222:

Click to download the PDB-style file with coordinates for d1pd222.
(The format of our PDB-style files is described here.)

Timeline for d1pd222:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd221