SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hn1a_ (5hn1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053509Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2053510Protein automated matches [190764] (2 species)
    not a true protein
  7. 2053518Species Human (Homo sapiens) [TaxId:9606] [187978] (6 PDB entries)
  8. 2286777Domain d5hn1a_: 5hn1 A: [330078]
    automated match to d4p0la_
    complexed with so4

Details for d5hn1a_

PDB Entry: 5hn1 (more details), 2.25 Å

PDB Description: crystal structure of interleukin-37
PDB Compounds: (A:) Interleukin-37

SCOPe Domain Sequences for d5hn1a_:

Sequence, based on SEQRES records: (download)

>d5hn1a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spkvknlnpkkfsihdqdhkvlvldsgnliavpdknyirpeiffalasslssasaekgsp
illgvskgefclycdkdkgqshpslqlkkeklmklaaqkesarrpfifyraqvgswnmle
saahpgwfictscncnepvgvtdkfenrkhiefsfqpv

Sequence, based on observed residues (ATOM records): (download)

>d5hn1a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spkvknlnpkkfsihdqdhkvlvldsgnliavpdknyirpeiffalasslssasaekgsp
illgvskgefclycdkdgqshpslqlkkeklmklaaqkesarrpfifyraqvgswnmles
aahpgwfictscncnepvgvtdkfenrkhiefsfqpv

SCOPe Domain Coordinates for d5hn1a_:

Click to download the PDB-style file with coordinates for d5hn1a_.
(The format of our PDB-style files is described here.)

Timeline for d5hn1a_:

  • d5hn1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23