Lineage for d5hr1b_ (5hr1 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117246Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries)
  8. 2286774Domain d5hr1b_: 5hr1 B: [330075]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr1b_

PDB Entry: 5hr1 (more details), 2.14 Å

PDB Description: crystal structure of thioredoxin l107a mutant
PDB Compounds: (B:) Thioredoxin-1

SCOPe Domain Sequences for d5hr1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr1b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana

SCOPe Domain Coordinates for d5hr1b_:

Click to download the PDB-style file with coordinates for d5hr1b_.
(The format of our PDB-style files is described here.)

Timeline for d5hr1b_:

  • d5hr1b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23