SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m4pa1 (5m4p A:6-169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993195Protein automated matches [230549] (2 species)
    not a true protein
  7. 1993196Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries)
  8. 2286773Domain d5m4pa1: 5m4p A:6-169 [330074]
    automated match to d1y8pa1
    complexed with 7fe, cl, tf3

Details for d5m4pa1

PDB Entry: 5m4p (more details), 2.3 Å

PDB Description: application of off-rate screening in the identification of novel pan- isoform inhibitors of pyruvate dehydrogenase kinase
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5m4pa1:

Sequence, based on SEQRES records: (download)

>d5m4pa1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d5m4pa1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr
vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv
leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d5m4pa1:

Click to download the PDB-style file with coordinates for d5m4pa1.
(The format of our PDB-style files is described here.)

Timeline for d5m4pa1:

  • d5m4pa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23