Lineage for d5m4pa1 (5m4p A:6-169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993195Protein automated matches [230549] (2 species)
    not a true protein
  7. 1993196Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries)
  8. 2286773Domain d5m4pa1: 5m4p A:6-169 [330074]
    automated match to d1y8pa1
    complexed with 7fe, cl, tf3

Details for d5m4pa1

PDB Entry: 5m4p (more details), 2.3 Å

PDB Description: application of off-rate screening in the identification of novel pan- isoform inhibitors of pyruvate dehydrogenase kinase
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5m4pa1:

Sequence, based on SEQRES records: (download)

>d5m4pa1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d5m4pa1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr
vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv
leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d5m4pa1:

Click to download the PDB-style file with coordinates for d5m4pa1.
(The format of our PDB-style files is described here.)

Timeline for d5m4pa1:

  • d5m4pa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23