SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m4ea_ (5m4e A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2191125Protein automated matches [190229] (10 species)
    not a true protein
  7. 2191138Species Human (Homo sapiens) [TaxId:9606] [187292] (120 PDB entries)
  8. 2286770Domain d5m4ea_: 5m4e A: [330071]
    automated match to d2xjxa_
    complexed with 7f9, so4

Details for d5m4ea_

PDB Entry: 5m4e (more details), 1.9 Å

PDB Description: application of off-rate screening in the identification of novel pan- isoform inhibitors of pyruvate dehydrogenase kinase
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5m4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m4ea_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5m4ea_:

Click to download the PDB-style file with coordinates for d5m4ea_.
(The format of our PDB-style files is described here.)

Timeline for d5m4ea_:

  • d5m4ea_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23