Lineage for d5hn1b_ (5hn1 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053509Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2053510Protein automated matches [190764] (2 species)
    not a true protein
  7. 2053518Species Human (Homo sapiens) [TaxId:9606] [187978] (6 PDB entries)
  8. 2286769Domain d5hn1b_: 5hn1 B: [330070]
    automated match to d4p0la_
    complexed with so4

Details for d5hn1b_

PDB Entry: 5hn1 (more details), 2.25 Å

PDB Description: crystal structure of interleukin-37
PDB Compounds: (B:) Interleukin-37

SCOPe Domain Sequences for d5hn1b_:

Sequence, based on SEQRES records: (download)

>d5hn1b_ b.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvknlnpkkfsihdqdhkvlvldsgnliavpdknyirpeiffalasslssasaekgspi
llgvskgefclycdkdkgqshpslqlkkeklmklaaqkesarrpfifyraqvgswnmles
aahpgwfictscncnepvgvtdkfenrkhiefsfqpv

Sequence, based on observed residues (ATOM records): (download)

>d5hn1b_ b.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvknlnpkkfsihdqdhkvlvldsgnliavpdknyirpeiffalasslssasaekgspi
llgvskgefclycdkshpslqlkkeklmklaaqkesarrpfifyraqgswnmlesaahpg
wfictscncnepvgvtdkfkhiefsfqpv

SCOPe Domain Coordinates for d5hn1b_:

Click to download the PDB-style file with coordinates for d5hn1b_.
(The format of our PDB-style files is described here.)

Timeline for d5hn1b_:

  • d5hn1b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23