Lineage for d5luva_ (5luv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970802Species Pseudomonas putida [TaxId:390235] [330064] (1 PDB entry)
  8. 2970803Domain d5luva_: 5luv A: [330065]
    Other proteins in same PDB: d5luvb2
    automated match to d3sw1a_
    complexed with cl, so4

Details for d5luva_

PDB Entry: 5luv (more details), 2.5 Å

PDB Description: short lov protein w619_1 in apo-state
PDB Compounds: (A:) Putative PAS/PAC sensor protein

SCOPe Domain Sequences for d5luva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5luva_ d.110.3.0 (A:) automated matches {Pseudomonas putida [TaxId: 390235]}
minaqllqsmvdasndgivvaeqegddtiliyvnpaferltgysrdeilyqdcrflqgdd
rdqlararirkalaegrpcrevlrnyrkdgsafwnelsitpvkcdadhrtyfigiqkdvs
rqvelerelaemhv

SCOPe Domain Coordinates for d5luva_:

Click to download the PDB-style file with coordinates for d5luva_.
(The format of our PDB-style files is described here.)

Timeline for d5luva_: