SCOPe 2.06: Domain d5itwa1: 5itw A:3-255

Lineage for d5itwa1 (5itw A:3-255)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries)

8. Domain d5itwa1: 5itw A:3-255 [330060]
   Other proteins in same PDB: d5itwa2, d5itwb2, d5itwc2, d5itwd2
   automated match to d4za2a_
   complexed with so4

Details for d5itwa1

PDB Entry: 5itw, 1.19 Å

PDB Description: crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase

PDB Compounds: (A:) Dihydroanticapsin 7-dehydrogenase

SCOPe Domain Sequences for d5itwa1:

Sequence; same for both SEQRES and ATOM records:

>d5itwa1 c.2.1.0 (A:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt
gsaitadggytaq

Timeline for d5itwa1:

• d5itwa1 is new in SCOPe 2.06-stable
  
• d5itwa1 appears in SCOPe 2.07
  
• d5itwa1 appears in the current release, SCOPe 2.08