SCOPe 2.06: Domain d5hr1f_: 5hr1 F:

Lineage for d5hr1f_ (5hr1 F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries)

8. Domain d5hr1f_: 5hr1 F: [330058]
   automated match to d2trxa_
   complexed with cu; mutant

Details for d5hr1f_

PDB Entry: 5hr1, 2.14 Å

PDB Description: crystal structure of thioredoxin l107a mutant

PDB Compounds: (F:) Thioredoxin-1

SCOPe Domain Sequences for d5hr1f_:

Sequence; same for both SEQRES and ATOM records:

>d5hr1f_ c.47.1.1 (F:) automated matches {Escherichia coli [TaxId: 83334]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana

Timeline for d5hr1f_:

• d5hr1f_ is new in SCOPe 2.06-stable
  
• d5hr1f_ appears in SCOPe 2.07
  
• d5hr1f_ appears in the current release, SCOPe 2.08