Lineage for d5hr3a_ (5hr3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117241Species Escherichia coli [TaxId:562] [187670] (3 PDB entries)
  8. 2286755Domain d5hr3a_: 5hr3 A: [330056]
    automated match to d2trxa_
    complexed with cu, eoh, so4; mutant

Details for d5hr3a_

PDB Entry: 5hr3 (more details), 1.1 Å

PDB Description: crystal structure of thioredoxin n106a mutant
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5hr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr3a_ c.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala

SCOPe Domain Coordinates for d5hr3a_:

Click to download the PDB-style file with coordinates for d5hr3a_.
(The format of our PDB-style files is described here.)

Timeline for d5hr3a_:

  • d5hr3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23