SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5itva1 (5itv A:3-255)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2286727Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries)
  8. 2286753Domain d5itva1: 5itv A:3-255 [330054]
    Other proteins in same PDB: d5itva2, d5itvb2, d5itvc2, d5itvd2
    automated match to d4za2a_
    complexed with nai

Details for d5itva1

PDB Entry: 5itv (more details), 2.26 Å

PDB Description: crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh
PDB Compounds: (A:) Dihydroanticapsin 7-dehydrogenase

SCOPe Domain Sequences for d5itva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itva1 c.2.1.0 (A:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt
gsaitadggytaq

SCOPe Domain Coordinates for d5itva1:

Click to download the PDB-style file with coordinates for d5itva1.
(The format of our PDB-style files is described here.)

Timeline for d5itva1:

  • d5itva1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23