SCOPe 2.08: Domain d5itva1: 5itv A:3-255

Lineage for d5itva1 (5itv A:3-255)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries)

8. Domain d5itva1: 5itv A:3-255 [330054]
   Other proteins in same PDB: d5itva2, d5itvb2, d5itvc2, d5itvd2
   automated match to d4za2a_
   complexed with nai

Details for d5itva1

PDB Entry: 5itv, 2.26 Å

PDB Description: crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh

PDB Compounds: (A:) Dihydroanticapsin 7-dehydrogenase

SCOPe Domain Sequences for d5itva1:

Sequence; same for both SEQRES and ATOM records:

>d5itva1 c.2.1.0 (A:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt
gsaitadggytaq

Timeline for d5itva1:

• d5itva1 first appeared in SCOPe 2.06
  
• d5itva1 appears in SCOPe 2.07