Lineage for d5goui_ (5gou I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701140Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries)
  8. 2701378Domain d5goui_: 5gou I: [330050]
    automated match to d3ajoa_

Details for d5goui_

PDB Entry: 5gou (more details), 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (I:) ferritin heavy chain

SCOPe Domain Sequences for d5goui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5goui_ a.25.1.1 (I:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatd
kndphlcdfieth

SCOPe Domain Coordinates for d5goui_:

Click to download the PDB-style file with coordinates for d5goui_.
(The format of our PDB-style files is described here.)

Timeline for d5goui_: