SCOP 1.67: Domain d3ljra2: 3ljr A:1-79

Lineage for d3ljra2 (3ljr A:1-79)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class theta GST [81361] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries)

8. Domain d3ljra2: 3ljr A:1-79 [33005]
   Other proteins in same PDB: d3ljra1, d3ljrb1

Details for d3ljra2

PDB Entry: 3ljr, 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

SCOP Domain Sequences for d3ljra2:

Sequence; same for both SEQRES and ATOM records:

>d3ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens)}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

Timeline for d3ljra2:

• d3ljra2 first appeared (with stable ids) in SCOP 1.55
  
• d3ljra2 appears in SCOP 1.65
  
• d3ljra2 appears in SCOP 1.69
  
• d3ljra2 appears in the current release, SCOPe 2.08