Lineage for d3ljra2 (3ljr A:1-79)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123473Species Human (Homo sapiens), class theta [TaxId:9606] [52874] (3 PDB entries)
  8. 123478Domain d3ljra2: 3ljr A:1-79 [33005]
    Other proteins in same PDB: d3ljra1, d3ljrb1

Details for d3ljra2

PDB Entry: 3ljr (more details), 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

SCOP Domain Sequences for d3ljra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljra2 c.47.1.5 (A:1-79) Glutathione S-transferase {Human (Homo sapiens), class theta}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

SCOP Domain Coordinates for d3ljra2:

Click to download the PDB-style file with coordinates for d3ljra2.
(The format of our PDB-style files is described here.)

Timeline for d3ljra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljra1