SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5goup_ (5gou P:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (26 species)
    not a true protein
  7. 1989604Species Human (Homo sapiens) [TaxId:9606] [187027] (24 PDB entries)
  8. 2286746Domain d5goup_: 5gou P: [330047]
    automated match to d3ajoa_

Details for d5goup_

PDB Entry: 5gou (more details), 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (P:) ferritin heavy chain

SCOPe Domain Sequences for d5goup_:

Sequence, based on SEQRES records: (download)

>d5goup_ a.25.1.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdfi
ethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Sequence, based on observed residues (ATOM records): (download)

>d5goup_ a.25.1.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkeqvkaikelgdhvt
nlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5goup_:

Click to download the PDB-style file with coordinates for d5goup_.
(The format of our PDB-style files is described here.)

Timeline for d5goup_:

  • d5goup_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23