Lineage for d5goul_ (5gou L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (27 species)
    not a true protein
  7. 1989604Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries)
  8. 2286741Domain d5goul_: 5gou L: [330042]
    automated match to d3ajoa_

Details for d5goul_

PDB Entry: 5gou (more details), 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (L:) ferritin heavy chain

SCOPe Domain Sequences for d5goul_:

Sequence, based on SEQRES records: (download)

>d5goul_ a.25.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdfi
ethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd

Sequence, based on observed residues (ATOM records): (download)

>d5goul_ a.25.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklneqvkaikelgdh
vtnlrkmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d5goul_:

Click to download the PDB-style file with coordinates for d5goul_.
(The format of our PDB-style files is described here.)

Timeline for d5goul_:

  • d5goul_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23