SCOPe 2.08: Domain d2ljrb2: 2ljr B:1-79

Lineage for d2ljrb2 (2ljr B:1-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class theta GST [81361] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries)

8. Domain d2ljrb2: 2ljr B:1-79 [33004]
   Other proteins in same PDB: d2ljra1, d2ljrb1

Details for d2ljrb2

PDB Entry: 2ljr, 3.2 Å

PDB Description: glutathione transferase apo-form from human

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2ljrb2:

Sequence; same for both SEQRES and ATOM records:

>d2ljrb2 c.47.1.5 (B:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

Timeline for d2ljrb2:

• d2ljrb2 first appeared (with stable ids) in SCOP 1.55
  
• d2ljrb2 appears in SCOPe 2.07