Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Escherichia coli [TaxId:562] [187670] (4 PDB entries) |
Domain d5hr0b_: 5hr0 B: [330039] automated match to d2trxa_ complexed with cu; mutant |
PDB Entry: 5hr0 (more details), 1.31 Å
SCOPe Domain Sequences for d5hr0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hr0b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkgfldanl
Timeline for d5hr0b_: