Lineage for d5hr0b_ (5hr0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117241Species Escherichia coli [TaxId:562] [187670] (3 PDB entries)
  8. 2286738Domain d5hr0b_: 5hr0 B: [330039]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr0b_

PDB Entry: 5hr0 (more details), 1.31 Å

PDB Description: crystal structure of thioredoxin e101g mutant
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5hr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr0b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkgfldanl

SCOPe Domain Coordinates for d5hr0b_:

Click to download the PDB-style file with coordinates for d5hr0b_.
(The format of our PDB-style files is described here.)

Timeline for d5hr0b_:

  • d5hr0b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22