SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hr0b_ (5hr0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117241Species Escherichia coli [TaxId:562] [187670] (3 PDB entries)
  8. 2286738Domain d5hr0b_: 5hr0 B: [330039]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr0b_

PDB Entry: 5hr0 (more details), 1.31 Å

PDB Description: crystal structure of thioredoxin e101g mutant
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5hr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr0b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkgfldanl

SCOPe Domain Coordinates for d5hr0b_:

Click to download the PDB-style file with coordinates for d5hr0b_.
(The format of our PDB-style files is described here.)

Timeline for d5hr0b_:

  • d5hr0b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22