SCOPe 2.08: Domain d5hr0b_: 5hr0 B:

Lineage for d5hr0b_ (5hr0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187670] (4 PDB entries)

8. Domain d5hr0b_: 5hr0 B: [330039]
   automated match to d2trxa_
   complexed with cu; mutant

Details for d5hr0b_

PDB Entry: 5hr0, 1.31 Å

PDB Description: crystal structure of thioredoxin e101g mutant

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5hr0b_:

Sequence; same for both SEQRES and ATOM records:

>d5hr0b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkgfldanl

Timeline for d5hr0b_:

• d5hr0b_ first appeared in SCOPe 2.06
  
• d5hr0b_ appears in SCOPe 2.07