Lineage for d5idzb2 (5idz B:141-434)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2086989Family c.1.11.1: Enolase [51605] (2 protein domains)
    automatically mapped to Pfam PF00113
  6. 2086990Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2087034Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
    Uniprot P09104
  8. 2286731Domain d5idzb2: 5idz B:141-434 [330032]
    Other proteins in same PDB: d5idza1, d5idza3, d5idzb1
    automated match to d2akza1
    complexed with 6bm, mg, pge

Details for d5idzb2

PDB Entry: 5idz (more details), 2.63 Å

PDB Description: structure of human enolase 2 in complex with (s)-(1-hydroxy-2- oxopiperidin-3-yl)phosphonate
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d5idzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idzb2 c.1.11.1 (B:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d5idzb2:

Click to download the PDB-style file with coordinates for d5idzb2.
(The format of our PDB-style files is described here.)

Timeline for d5idzb2:

  • d5idzb2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23