Lineage for d5idzb1 (5idz B:1-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947678Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. 2947712Domain d5idzb1: 5idz B:1-140 [330031]
    Other proteins in same PDB: d5idza2, d5idza3, d5idzb2
    automated match to d2akza2
    complexed with 6bm, mg, pge

Details for d5idzb1

PDB Entry: 5idz (more details), 2.63 Å

PDB Description: structure of human enolase 2 in complex with (s)-(1-hydroxy-2- oxopiperidin-3-yl)phosphonate
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d5idzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idzb1 d.54.1.1 (B:1-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
agaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d5idzb1:

Click to download the PDB-style file with coordinates for d5idzb1.
(The format of our PDB-style files is described here.)

Timeline for d5idzb1: