Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein Enolase [54828] (10 species) |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries) Uniprot P09104 |
Domain d5idzb1: 5idz B:1-140 [330031] Other proteins in same PDB: d5idza2, d5idza3, d5idzb2 automated match to d2akza2 complexed with 6bm, mg, pge |
PDB Entry: 5idz (more details), 2.63 Å
SCOPe Domain Sequences for d5idzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idzb1 d.54.1.1 (B:1-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck agaaerelplyrhiaqlagn
Timeline for d5idzb1: