SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5idzb1 (5idz B:1-140)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170980Protein Enolase [54828] (10 species)
  7. 2171024Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (13 PDB entries)
    Uniprot P09104
  8. 2286730Domain d5idzb1: 5idz B:1-140 [330031]
    Other proteins in same PDB: d5idza2, d5idza3, d5idzb2
    automated match to d2akza2
    complexed with 6bm, mg, pge

Details for d5idzb1

PDB Entry: 5idz (more details), 2.63 Å

PDB Description: structure of human enolase 2 in complex with (s)-(1-hydroxy-2- oxopiperidin-3-yl)phosphonate
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d5idzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idzb1 d.54.1.1 (B:1-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
agaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d5idzb1:

Click to download the PDB-style file with coordinates for d5idzb1.
(The format of our PDB-style files is described here.)

Timeline for d5idzb1:

  • d5idzb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22