Lineage for d2ljra2 (2ljr A:1-79)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 487028Protein Class theta GST [81361] (1 species)
  7. 487029Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries)
  8. 487032Domain d2ljra2: 2ljr A:1-79 [33003]
    Other proteins in same PDB: d2ljra1, d2ljrb1

Details for d2ljra2

PDB Entry: 2ljr (more details), 3.2 Å

PDB Description: glutathione transferase apo-form from human

SCOP Domain Sequences for d2ljra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens)}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

SCOP Domain Coordinates for d2ljra2:

Click to download the PDB-style file with coordinates for d2ljra2.
(The format of our PDB-style files is described here.)

Timeline for d2ljra2:

487032
d2ljra2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ljra1