SCOP 1.57: Domain d2ljra2: 2ljr A:1-79

Lineage for d2ljra2 (2ljr A:1-79)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Human (Homo sapiens), class theta [TaxId:9606] [52874] (3 PDB entries)

8. Domain d2ljra2: 2ljr A:1-79 [33003]
   Other proteins in same PDB: d2ljra1, d2ljrb1

Details for d2ljra2

PDB Entry: 2ljr, 3.2 Å

PDB Description: glutathione transferase apo-form from human

SCOP Domain Sequences for d2ljra2:

Sequence; same for both SEQRES and ATOM records:

>d2ljra2 c.47.1.5 (A:1-79) Glutathione S-transferase {Human (Homo sapiens), class theta}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

Timeline for d2ljra2:

• d2ljra2 first appeared (with stable ids) in SCOP 1.55
  
• d2ljra2 appears in SCOP 1.59
  
• d2ljra2 appears in the current release, SCOPe 2.08