Lineage for d5itvd1 (5itv D:3-255)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2286727Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries)
  8. 2286728Domain d5itvd1: 5itv D:3-255 [330029]
    Other proteins in same PDB: d5itva2, d5itvb2, d5itvc2, d5itvd2
    automated match to d4za2a_
    complexed with nai

Details for d5itvd1

PDB Entry: 5itv (more details), 2.26 Å

PDB Description: crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh
PDB Compounds: (D:) Dihydroanticapsin 7-dehydrogenase

SCOPe Domain Sequences for d5itvd1:

Sequence, based on SEQRES records: (download)

>d5itvd1 c.2.1.0 (D:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt
gsaitadggytaq

Sequence, based on observed residues (ATOM records): (download)

>d5itvd1 c.2.1.0 (D:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtlrlgkpeeianvmlflasdlssymtgsaitadggytaq

SCOPe Domain Coordinates for d5itvd1:

Click to download the PDB-style file with coordinates for d5itvd1.
(The format of our PDB-style files is described here.)

Timeline for d5itvd1:

  • d5itvd1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22