Lineage for d5jeia1 (5jei A:3-264)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (27 species)
    not a true protein
  7. 2145284Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries)
  8. 2286713Domain d5jeia1: 5jei A:3-264 [330014]
    Other proteins in same PDB: d5jeia2
    automated match to d5ftia_
    complexed with edo, ete, fwd, na, peg, pg0, pg4, po4, toe

Details for d5jeia1

PDB Entry: 5jei (more details), 1.23 Å

PDB Description: crystal structure of the glua2 lbd in complex with fw
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5jeia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jeia1 c.94.1.1 (A:3-264) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiacfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgsg

SCOPe Domain Coordinates for d5jeia1:

Click to download the PDB-style file with coordinates for d5jeia1.
(The format of our PDB-style files is described here.)

Timeline for d5jeia1:

  • d5jeia1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5jeia2