SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jeia1 (5jei A:3-264)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (23 species)
    not a true protein
  7. 2145284Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (33 PDB entries)
  8. 2286713Domain d5jeia1: 5jei A:3-264 [330014]
    Other proteins in same PDB: d5jeia2
    automated match to d5ftia_
    complexed with edo, ete, fwd, na, peg, pg0, pg4, po4, toe

Details for d5jeia1

PDB Entry: 5jei (more details), 1.23 Å

PDB Description: crystal structure of the glua2 lbd in complex with fw
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5jeia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jeia1 c.94.1.1 (A:3-264) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiacfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgsg

SCOPe Domain Coordinates for d5jeia1:

Click to download the PDB-style file with coordinates for d5jeia1.
(The format of our PDB-style files is described here.)

Timeline for d5jeia1:

  • d5jeia1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5jeia2