SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ggya1 (5ggy A:55-319)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (33 species)
    not a true protein
  7. 2286706Species Vibrio cholerae [TaxId:345073] [330007] (2 PDB entries)
  8. 2286707Domain d5ggya1: 5ggy A:55-319 [330008]
    Other proteins in same PDB: d5ggya2, d5ggyn2
    automated match to d1efdn_
    complexed with cl

Details for d5ggya1

PDB Entry: 5ggy (more details), 2.5 Å

PDB Description: x-ray crystal structure of periplasmic desferal binding protein fhud from vibrio cholerae
PDB Compounds: (A:) Iron(III) ABC transporter, periplasmic iron-compound-binding protein

SCOPe Domain Sequences for d5ggya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ggya1 c.92.2.0 (A:55-319) automated matches {Vibrio cholerae [TaxId: 345073]}
rvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvqdigtrtepnlekiaalk
pdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishfktlatlfgkeavaqqkl
eamyarfselkaslqhafgdtlpavvtlrfanptsvflytenstpqyvleqlglssalpq
ppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwrampfvqagrvnsvrpvws
yggamslrysaeaitesllavapqs

SCOPe Domain Coordinates for d5ggya1:

Click to download the PDB-style file with coordinates for d5ggya1.
(The format of our PDB-style files is described here.)

Timeline for d5ggya1:

  • d5ggya1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ggya2