SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ilva_ (5ilv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (65 species)
    not a true protein
  7. 1983803Species Human (Homo sapiens) [TaxId:9606] [186924] (15 PDB entries)
  8. 2286704Domain d5ilva_: 5ilv A: [330005]
    automated match to d4avpa_

Details for d5ilva_

PDB Entry: 5ilv (more details), 1.8 Å

PDB Description: uninhibited etv5
PDB Compounds: (A:) ets translocation variant 5

SCOPe Domain Sequences for d5ilva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilva_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gslqlwqflvtllddpanahfiawtgrgmefkliepeevarrwgiqknrpamnydklsrs
lryyyekgimqkvageryvykfvcdpdalfsm

SCOPe Domain Coordinates for d5ilva_:

Click to download the PDB-style file with coordinates for d5ilva_.
(The format of our PDB-style files is described here.)

Timeline for d5ilva_:

  • d5ilva_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22