Lineage for d5ilva_ (5ilv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 1983803Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)
  8. 2286704Domain d5ilva_: 5ilv A: [330005]
    automated match to d4avpa_

Details for d5ilva_

PDB Entry: 5ilv (more details), 1.8 Å

PDB Description: uninhibited etv5
PDB Compounds: (A:) ets translocation variant 5

SCOPe Domain Sequences for d5ilva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilva_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gslqlwqflvtllddpanahfiawtgrgmefkliepeevarrwgiqknrpamnydklsrs
lryyyekgimqkvageryvykfvcdpdalfsm

SCOPe Domain Coordinates for d5ilva_:

Click to download the PDB-style file with coordinates for d5ilva_.
(The format of our PDB-style files is described here.)

Timeline for d5ilva_:

  • d5ilva_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22