Lineage for d1gukb2 (1guk B:5-79)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486675Protein Class alpha GST [81360] (8 species)
  7. 486733Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [52873] (2 PDB entries)
  8. 486737Domain d1gukb2: 1guk B:5-79 [33000]
    Other proteins in same PDB: d1guka1, d1gukb1

Details for d1gukb2

PDB Entry: 1guk (more details), 2.9 Å

PDB Description: crystal structure of murine alpha-class gsta4-4

SCOP Domain Sequences for d1gukb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gukb2 c.47.1.5 (B:5-79) Class alpha GST {Mouse (Mus musculus), (a1-4)}
pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
ltqtrailsylaaky

SCOP Domain Coordinates for d1gukb2:

Click to download the PDB-style file with coordinates for d1gukb2.
(The format of our PDB-style files is described here.)

Timeline for d1gukb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gukb1