SCOPe 2.06: Domain d5ft3a2: 5ft3 A:87-220

Lineage for d5ft3a2 (5ft3 A:87-220)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Aedes aegypti [TaxId:7159] [329973] (1 PDB entry)

8. Domain d5ft3a2: 5ft3 A:87-220 [329994]
   Other proteins in same PDB: d5ft3a1, d5ft3b1
   automated match to d3zmka2
   complexed with gsh

Details for d5ft3a2

PDB Entry: 5ft3, 1.43 Å

PDB Description: aedes aegypti gste2

PDB Compounds: (A:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3a2:

Sequence; same for both SEQRES and ATOM records:

>d5ft3a2 a.45.1.0 (A:87-220) automated matches {Aedes aegypti [TaxId: 7159]}
skelvkqaklnaalhfesgvlfarlrfvcepilfaggseipadraeyvqkayqlledtlv
ddyivgnsltiadfscvssvssimgvipmdkekfpkiygwldrlkalpyyeaangsgaeq
vaqfvlsqkeknaq

Timeline for d5ft3a2:

• d5ft3a2 is new in SCOPe 2.06-stable
  
• d5ft3a2 appears in SCOPe 2.07
  
• d5ft3a2 appears in the current release, SCOPe 2.08