Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Aedes aegypti [TaxId:7159] [329973] (1 PDB entry) |
Domain d5ft3a2: 5ft3 A:87-220 [329994] Other proteins in same PDB: d5ft3a1, d5ft3b1 automated match to d3zmka2 complexed with gsh |
PDB Entry: 5ft3 (more details), 1.43 Å
SCOPe Domain Sequences for d5ft3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ft3a2 a.45.1.0 (A:87-220) automated matches {Aedes aegypti [TaxId: 7159]} skelvkqaklnaalhfesgvlfarlrfvcepilfaggseipadraeyvqkayqlledtlv ddyivgnsltiadfscvssvssimgvipmdkekfpkiygwldrlkalpyyeaangsgaeq vaqfvlsqkeknaq
Timeline for d5ft3a2: