Lineage for d1guka2 (1guk A:5-79)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132073Protein Class alpha GST [81360] (8 species)
  7. 2132191Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [52873] (2 PDB entries)
  8. 2132194Domain d1guka2: 1guk A:5-79 [32999]
    Other proteins in same PDB: d1guka1, d1gukb1

Details for d1guka2

PDB Entry: 1guk (more details), 2.9 Å

PDB Description: crystal structure of murine alpha-class gsta4-4
PDB Compounds: (A:) glutathione s-transferase a4-4

SCOPe Domain Sequences for d1guka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guka2 c.47.1.5 (A:5-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}
pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
ltqtrailsylaaky

SCOPe Domain Coordinates for d1guka2:

Click to download the PDB-style file with coordinates for d1guka2.
(The format of our PDB-style files is described here.)

Timeline for d1guka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guka1