Lineage for d1guka2 (1guk A:5-79)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181196Species Mouse (Mus musculus), class alpha (a1-4) [TaxId:10090] [52873] (2 PDB entries)
  8. 181199Domain d1guka2: 1guk A:5-79 [32999]
    Other proteins in same PDB: d1guka1, d1gukb1

Details for d1guka2

PDB Entry: 1guk (more details), 2.9 Å

PDB Description: crystal structure of murine alpha-class gsta4-4

SCOP Domain Sequences for d1guka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guka2 c.47.1.5 (A:5-79) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-4)}
pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
ltqtrailsylaaky

SCOP Domain Coordinates for d1guka2:

Click to download the PDB-style file with coordinates for d1guka2.
(The format of our PDB-style files is described here.)

Timeline for d1guka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guka1