SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i3ca_ (5i3c A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125514Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)
  7. 2286683Species Escherichia coli [TaxId:331111] [329984] (1 PDB entry)
  8. 2286688Domain d5i3ca_: 5i3c A: [329989]
    automated match to d1k9sa_
    complexed with ac2, so4

Details for d5i3ca_

PDB Entry: 5i3c (more details), 2.32 Å

PDB Description: crystal structure of e.coli purine nucleoside phosphorylase with acycloguanosine
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d5i3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i3ca_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 331111]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d5i3ca_:

Click to download the PDB-style file with coordinates for d5i3ca_.
(The format of our PDB-style files is described here.)

Timeline for d5i3ca_:

  • d5i3ca_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22