SCOPe 2.06: Domain d5hr3b_: 5hr3 B:

Lineage for d5hr3b_ (5hr3 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187670] (3 PDB entries)

8. Domain d5hr3b_: 5hr3 B: [329987]
   automated match to d2trxa_
   complexed with cu, eoh, so4; mutant

Details for d5hr3b_

PDB Entry: 5hr3, 1.1 Å

PDB Description: crystal structure of thioredoxin n106a mutant

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5hr3b_:

Sequence; same for both SEQRES and ATOM records:

>d5hr3b_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala

Timeline for d5hr3b_:

• d5hr3b_ is new in SCOPe 2.06-stable
  
• d5hr3b_ appears in SCOPe 2.07
  
• d5hr3b_ appears in the current release, SCOPe 2.08