Lineage for d5fuqb_ (5fuq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102504Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2102677Protein automated matches [190235] (2 species)
    not a true protein
  7. 2102678Species Human (Homo sapiens) [TaxId:9606] [187003] (7 PDB entries)
  8. 2286674Domain d5fuqb_: 5fuq B: [329975]
    automated match to d1d4aa_
    complexed with act, dtc, fad

Details for d5fuqb_

PDB Entry: 5fuq (more details), 2.04 Å

PDB Description: crystal structure of the h80r variant of nqo1 bound to dicoumarol
PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d5fuqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuqb_ c.23.5.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
kevqdeeknkkfglsvghhlgksiptdnqikar

SCOPe Domain Coordinates for d5fuqb_:

Click to download the PDB-style file with coordinates for d5fuqb_.
(The format of our PDB-style files is described here.)

Timeline for d5fuqb_:

  • d5fuqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22