SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fuqb_ (5fuq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102504Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2102677Protein automated matches [190235] (2 species)
    not a true protein
  7. 2102678Species Human (Homo sapiens) [TaxId:9606] [187003] (7 PDB entries)
  8. 2286674Domain d5fuqb_: 5fuq B: [329975]
    automated match to d1d4aa_
    complexed with act, dtc, fad

Details for d5fuqb_

PDB Entry: 5fuq (more details), 2.04 Å

PDB Description: crystal structure of the h80r variant of nqo1 bound to dicoumarol
PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d5fuqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuqb_ c.23.5.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
kevqdeeknkkfglsvghhlgksiptdnqikar

SCOPe Domain Coordinates for d5fuqb_:

Click to download the PDB-style file with coordinates for d5fuqb_.
(The format of our PDB-style files is described here.)

Timeline for d5fuqb_:

  • d5fuqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22