SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ft3b2 (5ft3 B:87-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2286672Species Aedes aegypti [TaxId:7159] [329973] (1 PDB entry)
  8. 2286673Domain d5ft3b2: 5ft3 B:87-221 [329974]
    Other proteins in same PDB: d5ft3a1, d5ft3b1
    automated match to d3zmka2
    complexed with gsh

Details for d5ft3b2

PDB Entry: 5ft3 (more details), 1.43 Å

PDB Description: aedes aegypti gste2
PDB Compounds: (B:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft3b2 a.45.1.0 (B:87-221) automated matches {Aedes aegypti [TaxId: 7159]}
skelvkqaklnaalhfesgvlfarlrfvcepilfaggseipadraeyvqkayqlledtlv
ddyivgnsltiadfscvssvssimgvipmdkekfpkiygwldrlkalpyyeaangsgaeq
vaqfvlsqkeknaqk

SCOPe Domain Coordinates for d5ft3b2:

Click to download the PDB-style file with coordinates for d5ft3b2.
(The format of our PDB-style files is described here.)

Timeline for d5ft3b2:

  • d5ft3b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ft3b1