SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ftvb_ (5ftv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133386Protein automated matches [191218] (4 species)
    not a true protein
  7. 2286669Species Pseudomonas aeruginosa [TaxId:287] [329970] (6 PDB entries)
  8. 2286670Domain d5ftvb_: 5ftv B: [329971]
    automated match to d1fxob_
    complexed with cl, kdt, mes

Details for d5ftvb_

PDB Entry: 5ftv (more details), 2.21 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5ftvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftvb_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d5ftvb_:

Click to download the PDB-style file with coordinates for d5ftvb_.
(The format of our PDB-style files is described here.)

Timeline for d5ftvb_:

  • d5ftvb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22